| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MLL3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MLL3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MLL3. This antibody reacts with human. The MLL3 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human MLL3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TPPTMSQPTFPMVPQQLQHQQHTTVISGHTSPVRMPSLPGWQPNSAPAHLPLNPPRIQPPIAQLPIKTCTPAPGTVSNANPQ |
|---|
| Other Names | ALR-like protein, DKFZp686C08112, EC 2.1.1.43, FLJ12625, HALRMGC119851, histone-lysine N-methyltransferase MLL3, histone-lysine N-methyltransferase, H3 lysine-4 specific, Homologous to ALR protein, KIAA1506FLJ38309, KMT2C, KMT2CMGC119852, Lysine N-methyltransferase 2C, MGC119853, myeloid/lymphoid or mixed-lineage leukemia 3, Myeloid/lymphoid or mixed-lineage leukemia protein 3 |
|---|
| Gene, Accession # | KMT2C, Gene ID: 58508 |
|---|
| Catalog # | NBP2-57730 |
|---|
| Price | |
|---|
| Order / More Info | MLL3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|