| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MLL5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MLL5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MLL5. This antibody reacts with human. The MLL5 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human MLL5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TYSQEGYDRSSTMLTLGPFRNSNLTELGLQEIKTIGYTSPRSRTEVNRQCPGEKEPVSDLQLGLDAVEPTALHKTLETPAHDRAEPNSQLDSTH |
|---|
| Other Names | EC 2.1.1.43, FLJ10078, HDCMC04P, histone-lysine N-methyltransferase MLL5, KMT2EFLJ14026, Lysine N-methyltransferase 2E, MGC70452, myeloid/lymphoid or mixed-lineage leukemia 5 (trithorax homolog, Drosophila), Myeloid/lymphoid or mixed-lineage leukemia protein 5 |
|---|
| Gene, Accession # | MLL5, Gene ID: 55904, Accession: Q8IZD2, SwissProt: Q8IZD2 |
|---|
| Catalog # | NBP2-33775 |
|---|
| Price | |
|---|
| Order / More Info | MLL5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|