| Edit |   |
|---|
| Antigenic Specificity | MLKL |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunoprecipitation |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MLKL Antibody from Novus Biologicals is a rabbit polyclonal antibody to MLKL. This antibody reacts with human. The MLKL Antibody has been validated for the following applications: Western Blot, Immunoprecipitation. |
|---|
| Immunogen | Synthetic peptides corresponding to MLKL(mixed lineage kinase domain-like) The peptide sequence was selected from the N terminal of MLKL (NP_689862). Peptide sequence DVWKELSLLLQVEQRMPVSPISQGASWAQEDQQDADEDRRAFQMLRRDNE. |
|---|
| Other Names | FLJ34389, mixed lineage kinase domain-like, mixed lineage kinase domain-like protein |
|---|
| Gene, Accession # | MLKL, Gene ID: 197259, Accession: Q8NB16, SwissProt: Q8NB16 |
|---|
| Catalog # | NBP1-56729 |
|---|
| Price | |
|---|
| Order / More Info | MLKL Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 17353931, 22421439, 26109138, 26522725 |
|---|