| 产品详情 |
| Edit |   |
| Antigenic Specificity | RNASEH2A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | Protein A purified |
| Size | 100ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RNASEH2A Antibody from Novus Biologicals is a rabbit polyclonal antibody to RNASEH2A. This antibody reacts with human. The RNASEH2A Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. This product is specific to Subunit or Isoform: A |
| Immunogen | Synthetic peptides corresponding to RNASEH2A (ribonuclease H2, subunit A) The peptide sequence was selected from the middle region of RNASEH2A. Peptide sequence AQTILEKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLE. |
| Other Names | AGS4RNase H2 subunit A, Aicardi-Goutieres syndrome 4, Aicardi-Goutieres syndrome 4 protein, JUNB, ribonuclease H2 subunit A, ribonuclease H2, large subunit, ribonuclease H2, subunit A, Ribonuclease HI large subunit, Ribonuclease HI subunit A, ribonuclease HI, large subunit, RNase H(35), RNASEHIEC 3.1.26.4, RNHIARNase HI large subunit, RNHL |
| Gene, Accession # | RNASEH2A, Gene ID: 10535, Accession: O75792, SwissProt: O75792 |
| Catalog # | NBP1-58235 |
| Price | |
| Order / More Info | RNASEH2A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|