| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RNase H1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Proximity Ligation Assay. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. Use in Proximity Ligation Assay reported in scientific literature (PMID: 30337279). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RNase H1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RNase H1. This antibody reacts with human. The RNase H1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Proximity Ligation Assay. Specificity of human RNase H1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RGFGMFYAVRRGRKTGVFLTWNECRAQVDRFPAARFKKFATEDEAWAFVRKSASPEVSEGHENQHGQESEAKASKRL |
|---|
| Other Names | EC 3.1.26.4, H1RNA, Ribonuclease H type II, ribonuclease H1, RNase H1, RNH1 |
|---|
| Gene, Accession # | RNASEH1, Gene ID: 246243, Accession: O60930, SwissProt: O60930 |
|---|
| Catalog # | NBP2-38501 |
|---|
| Price | |
|---|
| Order / More Info | RNase H1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 29395064, 30337279 |
|---|
| 产品资料 |
|
|