| Edit |   |
|---|
| Antigenic Specificity | RNASE10 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RNASE10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RNASE10. This antibody reacts with human. The RNASE10 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human RNASE10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: YAFIHEDLNTVKAVCNSPVIACELKGGKCHKSSRPFDLTLCELSQPDQVTPNCNYLTSVIKKHIIITCNDMKRQLPTGQ |
|---|
| Other Names | ribonuclease 10, ribonuclease, RNase A family, 10 (non-active), ribonuclease-like protein 10, RNASE9 |
|---|
| Gene, Accession # | RNASE10, Gene ID: 338879, Accession: Q5GAN6, SwissProt: Q5GAN6 |
|---|
| Catalog # | NBP2-30865 |
|---|
| Price | |
|---|
| Order / More Info | RNASE10 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|