| Edit |   |
| Antigenic Specificity | RNA polymerase I termination factor |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RNA polymerase I termination factor Antibody from Novus Biologicals is a rabbit polyclonal antibody to RNA polymerase I termination factor. This antibody reacts with human. The RNA polymerase I termination factor Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to the middle region of TTF1. Immunizing peptide sequence KNSESTLFDSVEGDGAMMEEGVKSRPRQKKTQACLASKHVQEAPRLEPAN. |
| Other Names | RNA polymerase I termination factor, transcription termination factor 1, Transcription termination factor I, transcription termination factor, RNA polymerase I, TTF-1, TTF-I |
| Gene, Accession # | TTF1, Gene ID: 7270, Accession: Q15361, SwissProt: Q15361 |
| Catalog # | NBP1-74129-20ul |
| Price | |
| Order / More Info | RNA polymerase I termination factor Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |