| Edit |   |
|---|
| Antigenic Specificity | FER1L6-AS2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-FER1L6-AS2 Antibody |
|---|
| Immunogen | The immunogen for anti-FER1L6-AS2 antibody is: synthetic peptide directed towards the middle region of Human FER1L6-AS2. Synthetic peptide located within the following region: ELHLLHFPNSPEENLRKRPAEPSPQIHGGAPHLPWLCVEKSDLLPENHAV |
|---|
| Other Names | C8orf78, FER1L6 antisense RNA 2 |
|---|
| Gene, Accession # | FER1L6-AS2, Accession: NM_182525 |
|---|
| Catalog # | TA334795 |
|---|
| Price | |
|---|
| Order / More Info | FER1L6-AS2 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|