Edit |   |
Antigenic Specificity | TCF7 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit Polyclonal anti-TCF7 antibody |
Immunogen | The immunogen for anti-TCF7 antibody: synthetic peptide directed towards the middle region of human TCF7. Synthetic peptide located within the following region: MQLYPGWSARDNYGKKKRRSREKHQESTTETNWPRELKDGNGQESLSMSS |
Other Names | TCF1, transcription factor 7 (T-cell specific, HMG-box) |
Gene, Accession # | TCF7, Accession: NM_201634 |
Catalog # | TA329278 |
Price | |
Order / More Info | TCF7 Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |