| 产品详情 |
| Edit |   |
| Antigenic Specificity | MKP-1/DUSP1 |
| Clone | 3A9 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG2b kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MKP-1/DUSP1 Antibody (3A9) from Novus Biologicals is a mouse monoclonal antibody to MKP-1/DUSP1. This antibody reacts with human. The MKP-1/DUSP1 Antibody (3A9) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
| Immunogen | DUSP1 (NP_004408 305 a.a. - 367 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQSPITTSPSC |
| Other Names | CL100MAP kinase phosphatase 1, dual specificity phosphatase 1, Dual specificity protein phosphatase hVH1, EC 3.1.3.16, EC 3.1.3.48, HVH1, Mitogen-activated protein kinase phosphatase 1, MKP1, MKP-1dual specificity protein phosphatase 1, Protein-tyrosine phosphatase CL100, PTPN10serine/threonine specific protein phosphatase, VH1 |
| Gene, Accession # | DUSP1, Gene ID: 1843, Accession: NP_004408, SwissProt: NP_004408 |
| Catalog # | H00001843-M05 |
| Price | |
| Order / More Info | MKP-1/DUSP1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 27548147 |
| 产品资料 |
|
|