| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MKP-1/DUSP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MKP-1/DUSP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MKP-1/DUSP1. This antibody reacts with human. The MKP-1/DUSP1 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human MKP-1/DUSP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQS |
|---|
| Other Names | CL100MAP kinase phosphatase 1, dual specificity phosphatase 1, Dual specificity protein phosphatase hVH1, EC 3.1.3.16, EC 3.1.3.48, HVH1, Mitogen-activated protein kinase phosphatase 1, MKP1, MKP-1dual specificity protein phosphatase 1, Protein-tyrosine phosphatase CL100, PTPN10serine/threonine specific protein phosphatase, VH1 |
|---|
| Gene, Accession # | DUSP1, Gene ID: 1843 |
|---|
| Catalog # | NBP2-57354 |
|---|
| Price | |
|---|
| Order / More Info | MKP-1/DUSP1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|