| 产品详情 |
| Edit |   |
| Antigenic Specificity | Calcium Activated Nucleotidase 1/CANT1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Calcium Activated Nucleotidase 1/CANT1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Calcium Activated Nucleotidase 1/CANT1. This antibody reacts with human. The Calcium Activated Nucleotidase 1/CANT1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to CANT1(calcium activated nucleotidase 1) The peptide sequence was selected from the middle region of CANT1. Peptide sequence SPDFGDIAVSHVGAVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVASY. |
| Other Names | Apyrase homolog, calcium activated nucleotidase 1, DBQD, EC 3.6.1.6, Putative MAPK-activating protein PM09, Putative NF-kappa-B-activating protein 107, SCAN1, SCAN-1Ca2+-dependent endoplasmic reticulum nucleoside diphosphatase, SHAPYmicromelic dwarfism with vertebral and metaphyseal abnormalities and advancedcarpotarsal ossification, soluble Ca-activated nucleotidase, isozyme 1, soluble calcium-activated nucleotidase 1, soluble calcium-activated nucleotidase SCAN-1 |
| Gene, Accession # | CANT1, Gene ID: 124583, Accession: Q8WVQ1, SwissProt: Q8WVQ1 |
| Catalog # | NBP1-58875-20ul |
| Price | |
| Order / More Info | Calcium Activated Nucleotidase 1/CANT1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|