Edit |   |
Antigenic Specificity | RD3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit Polyclonal Anti-RD3 Antibody |
Immunogen | The immunogen for Anti-RD3 Antibody: synthetic peptide directed towards the N terminal of human RD3. Synthetic peptide located within the following region: GQMREAERQQRERSNAVRKVCTGVDYSWLASTPRSTYDLSPIERLQLEDV |
Other Names | C1orf36, LCA12, retinal degeneration 3 |
Gene, Accession # | RD3, Accession: NM_183059 |
Catalog # | TA333379 |
Price | |
Order / More Info | RD3 Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |