| Edit |   |
| Antigenic Specificity | GTF3A |
| Clone | 4B4 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG2b kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GTF3A Antibody (4B4) from Novus Biologicals is a mouse monoclonal antibody to GTF3A. This antibody reacts with human. The GTF3A Antibody (4B4) has been validated for the following applications: Western Blot, ELISA. |
| Immunogen | GTF3A (NP_002088 185 a.a. - 274 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NQQKQYICSFEDCKKTFKKHQQLKIHQCQNTNEPLFKCTQEGCGKHFASPSKLKRHAKAHEGYVCQKGCSFVAKTWTELLKHVRETHKEE |
| Other Names | general transcription factor IIIA, TFIIIAAP2, transcription factor IIIA |
| Gene, Accession # | GTF3A, Gene ID: 2971, Accession: NP_002088, SwissProt: NP_002088 |
| Catalog # | H00002971-M10 |
| Price | |
| Order / More Info | GTF3A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |