| Edit |   |
|---|
| Antigenic Specificity | GTF3A |
|---|
| Clone | 3F7 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA. Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GTF3A Antibody (3F7) from Novus Biologicals is a mouse monoclonal antibody to GTF3A. This antibody reacts with human. The GTF3A Antibody (3F7) has been validated for the following applications: ELISA. |
|---|
| Immunogen | GTF3A (NP_002088 185 a.a. - 274 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NQQKQYICSFEDCKKTFKKHQQLKIHQCQNTNEPLFKCTQEGCGKHFASPSKLKRHAKAHEGYVCQKGCSFVAKTWTELLKHVRETHKEE |
|---|
| Other Names | general transcription factor IIIA, TFIIIAAP2, transcription factor IIIA |
|---|
| Gene, Accession # | GTF3A, Gene ID: 2971, Accession: NP_002088, SwissProt: NP_002088 |
|---|
| Catalog # | H00002971-M07 |
|---|
| Price | |
|---|
| Order / More Info | GTF3A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|