| 产品详情 |
| Edit |   |
| Antigenic Specificity | GTF2A2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GTF2A2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GTF2A2. This antibody reacts with human. The GTF2A2 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human GTF2A2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE |
| Other Names | General transcription factor IIA subunit 2, general transcription factor IIA, 2 (12kD subunit), general transcription factor IIA, 2, 12kDa, HsT18745, TF2A2, TFIIA, TFIIA p12 subunit, TFIIA-12, TFIIA-gamma, TFIIAS, Transcription initiation factor IIA gamma chain, transcription initiation factor IIA subunit 2 |
| Gene, Accession # | GTF2A2, Gene ID: 2958 |
| Catalog # | NBP2-55408 |
| Price | |
| Order / More Info | GTF2A2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|