| Edit |   |
|---|
| Antigenic Specificity | G-substrate |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The G-substrate Antibody from Novus Biologicals is a rabbit polyclonal antibody to G-substrate. This antibody reacts with human. The G-substrate Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human C7orf16. Peptide sequence IKDCDLKKKPRKGKNVQATLNVESDQKKPRRKDTPALHIPPFIPGVFSEH. |
|---|
| Other Names | chromosome 7 open reading frame 16, GSBSG-substrate |
|---|
| Gene, Accession # | PPP1R17, Gene ID: 10842, Accession: NP_006649, SwissProt: NP_006649 |
|---|
| Catalog # | NBP1-79480 |
|---|
| Price | |
|---|
| Order / More Info | G-substrate Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|