| Edit |   |
| Antigenic Specificity | G-substrate |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 25ul |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The G-substrate Antibody from Novus Biologicals is a rabbit polyclonal antibody to G-substrate. This antibody reacts with human. The G-substrate Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DRLDKLDPRCSHLDDLSDQFIKDCDLKKKPRKGKNVQATLNVESDQKKPR RKDTPALH |
| Other Names | chromosome 7 open reading frame 16, GSBSG-substrate |
| Gene, Accession # | PPP1R17, Gene ID: 10842 |
| Catalog # | NBP2-13800-25ul |
| Price | |
| Order / More Info | G-substrate Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |