| Edit |   |
|---|
| Antigenic Specificity | SIRP delta |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SIRP delta Antibody from Novus Biologicals is a rabbit polyclonal antibody to SIRP delta. This antibody reacts with human. The SIRP delta Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SIRP delta antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: FHVQQTEMSQTVSTGESIILSCSVPDTLPNGPVLWFKGTGPNRKLIYNFKQGNFPRVKEIGDTTKPGNTDF |
|---|
| Other Names | dJ576H24.4, Protein tyrosine phosphatase non-receptor type substrate 1-like 2, protein tyrosine phosphatase, non-receptor type substrate 1-like 2, PTPNS1L2, signal-regulatory protein delta, SIRP-delta |
|---|
| Gene, Accession # | SIRPD, Gene ID: 128646, Accession: Q9H106, SwissProt: Q9H106 |
|---|
| Catalog # | NBP2-31924 |
|---|
| Price | |
|---|
| Order / More Info | SIRP delta Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|