| 产品详情 |
| Edit |   |
| Antigenic Specificity | SFRS14 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SFRS14 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SFRS14. This antibody reacts with human. The SFRS14 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SFRS14 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ESRDYDVDHPGEADSVLRGGSQVQARGRALNIVDQEGSLLGKGETQGLLTAKGGVGKLVTLRNVSTKKIPTVNRITPKTQGTNQIQKNTPSPDVTLG |
| Other Names | Arginine/serine-rich-splicing factor 14, DKFZp686M2322, DKFZp779L2418, KIAA0365arginine/serine-rich 14 splicing factor, putative splicing factor, arginine/serine-rich 14, SFRS14, Splicing factor, arginine/serine-rich 14FLJ21855, SRFS14, SURP and G patch domain containing 2, SURP and G-patch domain-containing protein 2 |
| Gene, Accession # | SUGP2, Gene ID: 10147, Accession: Q8IX01, SwissProt: Q8IX01 |
| Catalog # | NBP2-38906 |
| Price | |
| Order / More Info | SFRS14 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|