| 产品详情 |
| Edit |   |
| Antigenic Specificity | SFRS12 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SFRS12 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SFRS12. This antibody reacts with human. The SFRS12 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human SFRS12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PAPTMTSLMPGAGLLPIPTPNPLTTLGVSLSSLGAIPAAALDPNIATLGEIPQPPLMGNVDPSKIDEIRRTVYVGNLN |
| Other Names | DKFZp564B176, Serine/arginine-rich-splicing regulatory protein 86, SFRS12serine-arginine-rich-splicing regulatory protein 86, Splicing factor, arginine/serine-rich 12MGC133045, splicing regulatory glutamine/lysine-rich protein 1, Splicing regulatory protein 508, SRRp508, SRrp508SRrp86serine-arginine-rich splicing regulatory protein 508, SRRP86 |
| Gene, Accession # | SREK1, Gene ID: 140890 |
| Catalog # | NBP2-55143 |
| Price | |
| Order / More Info | SFRS12 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|