| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | sFRP-3/FRZB |
|---|
| Clone | 3F4 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The sFRP-3/FRZB Antibody (3F4) from Novus Biologicals is a mouse monoclonal antibody to sFRP-3/FRZB. This antibody reacts with human. The sFRP-3/FRZB Antibody (3F4) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | FRZB (NP_001454, 102 a.a. - 190 a.a.) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HEPIKPCKSVCERARQGCEPILIKYRHSWPENLACEELPVYDRGVCISPEAIVTADGADFPMDSSNGNCRGASSERCKCKPIRATQKTY* |
|---|
| Other Names | FIZ, FREOS1, Frezzled, Fritz, frizzled-related protein, Frizzled-related protein 1, FRP, FRP-3, FrzB-1, FRZB1sFRP-3, FRZB-PEN, FZRB, hFIZ, secreted frizzled-related protein 3, SFRP3frezzled, SRFP3frizzled homolog-related |
|---|
| Gene, Accession # | FRZB, Gene ID: 2487, Accession: NP_001454, SwissProt: NP_001454 |
|---|
| Catalog # | H00002487-M06 |
|---|
| Price | |
|---|
| Order / More Info | sFRP-3/FRZB Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|