| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | USP22 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The USP22 Antibody from Novus Biologicals is a rabbit polyclonal antibody to USP22. This antibody reacts with human. The USP22 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human USP22 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MVSRPEPEGEAMDAELAVAPPGCSHLGSFKVDNWKQNLRAIYQCF |
|---|
| Other Names | Deubiquitinating enzyme 22, EC 3.1.2.15, EC 3.4.19.12, KIAA1063ubiquitin carboxyl-terminal hydrolase 22, KIAA1064, ubiquitin specific peptidase 22, ubiquitin specific peptidase 3-like, ubiquitin specific protease 22, ubiquitin thioesterase 22, Ubiquitin thiolesterase 22, ubiquitin-specific processing protease 22, Ubiquitin-specific-processing protease 22, USP3L |
|---|
| Gene, Accession # | USP22, Gene ID: 23326, Accession: Q9UPT9, SwissProt: Q9UPT9 |
|---|
| Catalog # | NBP1-82941 |
|---|
| Price | |
|---|
| Order / More Info | USP22 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|