| Edit |   |
|---|
| Antigenic Specificity | BEND7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit polyclonal Anti-BEND7 Antibody |
|---|
| Immunogen | The immunogen for anti-BEND7 antibody: synthetic peptide directed towards the middle region of human BEND7. Synthetic peptide located within the following region: LGFGIVLESPSSDPEVQLAEGFDVFMPKSQLDSILSNYTRSGSLLFRKLV |
|---|
| Other Names | C10orf30, BEN domain containing 7 |
|---|
| Gene, Accession # | BEND7, Accession: NM_152751 |
|---|
| Catalog # | TA329785 |
|---|
| Price | |
|---|
| Order / More Info | BEND7 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|