| Edit |   |
|---|
| Antigenic Specificity | Bend6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit polyclonal Anti-Bend6 Antibody |
|---|
| Immunogen | The immunogen for anti-Bend6 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: FINDLMQVLYTNEYMATHSLTGAKSSTSRDKVVKPAMNQNEVQEIIGILK |
|---|
| Other Names | C6orf65, bA203B9.1, BEN domain containing 6 |
|---|
| Gene, Accession # | Bend6, Accession: NM_001108792 |
|---|
| Catalog # | TA329781 |
|---|
| Price | |
|---|
| Order / More Info | Bend6 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|