| Edit |   |
| Antigenic Specificity | TMEM57 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TMEM57 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM57. This antibody reacts with human. The TMEM57 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to TMEM57(transmembrane protein 57) The peptide sequence was selected from the N terminal of TMEM57. Peptide sequence VVWALVLLADFVLEFRFEYLWPFWLFIRSVYDSFRYQGLAFSVFFVCVAF. |
| Other Names | FLJ23007, MACOILIN, transmembrane protein 57FLJ10747 |
| Gene, Accession # | TMEM57, Gene ID: 55219, Accession: Q8N5G2, SwissProt: Q8N5G2 |
| Catalog # | NBP1-59709-20ul |
| Price | |
| Order / More Info | TMEM57 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |