| Edit |   |
|---|
| Antigenic Specificity | TMEM51 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TMEM51 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM51. This antibody reacts with human. The TMEM51 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to TMEM51(transmembrane protein 51) The peptide sequence was selected from the N terminal of TMEM51. Peptide sequence GFSAAEKPTAQGSNKTEVGGGILKSKTFSVAYVLVGAGVMLLLLSICLSI. |
|---|
| Other Names | C1orf72, chromosome 1 open reading frame 72, FLJ10199, transmembrane protein 51 |
|---|
| Gene, Accession # | TMEM51, Gene ID: 55092, Accession: Q9NW97, SwissProt: Q9NW97 |
|---|
| Catalog # | NBP1-69597 |
|---|
| Price | |
|---|
| Order / More Info | TMEM51 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|