| Edit |   |
| Antigenic Specificity | TMEM42 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TMEM42 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM42. This antibody reacts with human. The TMEM42 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to TMEM42 (transmembrane protein 42) The peptide sequence was selected from the N terminal of TMEM42)(50ug). Peptide sequence MAERPGPPGGAVSATAYPDTPAEFPPHLQAGAMRRRFWGVFNCLCAGAFG. |
| Other Names | MGC29956, transmembrane protein 42 |
| Gene, Accession # | TMEM42, Gene ID: 131616 |
| Catalog # | NBP1-57740 |
| Price | |
| Order / More Info | TMEM42 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |