| Edit |   |
| Antigenic Specificity | TMEM35 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TMEM35 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM35. This antibody reacts with human. The TMEM35 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to TMEM35(transmembrane protein 35) The peptide sequence was selected from the C terminal of TMEM35. Peptide sequence VFGILLTCRLLIARKPEDRSSEKKPLPGNAEEQPSLYEKAPQGKVKVS. |
| Other Names | FLJ14084, transmembrane protein 35 |
| Gene, Accession # | TMEM35, Gene ID: 59353, Accession: Q53FP2, SwissProt: Q53FP2 |
| Catalog # | NBP1-69343 |
| Price | |
| Order / More Info | TMEM35 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |