| Edit |   |
|---|
| Antigenic Specificity | TMEM35 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 25ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TMEM35 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM35. This antibody reacts with human. The TMEM35 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PRLSKDAYSEMKRAYKSYVRALPLLKKMGINSILLRKSIGALEVACGIVMTLVPGRPKDV |
|---|
| Other Names | FLJ14084, transmembrane protein 35 |
|---|
| Gene, Accession # | TMEM35, Gene ID: 59353, Accession: Q53FP2, SwissProt: Q53FP2 |
|---|
| Catalog # | NBP2-31877-25ul |
|---|
| Price | |
|---|
| Order / More Info | TMEM35 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|