| Edit |   |
|---|
| Antigenic Specificity | TMEM260 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TMEM260 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM260. This antibody reacts with human. The TMEM260 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human C14ORF101. Peptide sequence WGDQTTLQGFLTHFLREEYGTFSLAKSEIGSSMSEILLSQVTNMRTELSF. |
|---|
| Other Names | chromosome 14 open reading frame 101, FLJ20392, hypothetical protein LOC54916 |
|---|
| Gene, Accession # | C14ORF101, Gene ID: 54916, Accession: NP_060269, SwissProt: NP_060269 |
|---|
| Catalog # | NBP1-91525 |
|---|
| Price | |
|---|
| Order / More Info | TMEM260 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|