| Edit |   |
| Antigenic Specificity | TMEM184A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, dog, rat, guinea pig, horse, mouse |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-TMEM184A Antibody |
| Immunogen | The immunogen for anti-TMEM184A antibody: synthetic peptide directed towards the C terminal of human TMEM184A. Synthetic peptide located within the following region: CQVYAEKKENSPAPPAPMQSISSGIRETVSPQDIVQDAIHNFSPAYQHYT |
| Other Names | transmembrane protein 184A |
| Gene, Accession # | T184A, Accession: NM_001097620 |
| Catalog # | TA334991 |
| Price | |
| Order / More Info | TMEM184A Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |