| Edit |   |
| Antigenic Specificity | PDAP1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PDAP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PDAP1. This antibody reacts with human. The PDAP1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to PDAP1(PDGFA associated protein 1) The peptide sequence was selected from the N terminal of PDAP1. Peptide sequence MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGD. |
| Other Names | HASPP28, PAP1PDGFA-associated protein 1, PAP28 kDa heat- and acid-stable phosphoprotein, PDGFA associated protein 1, PDGF-associated protein |
| Gene, Accession # | PDAP1, Gene ID: 11333, Accession: Q13442, SwissProt: Q13442 |
| Catalog # | NBP1-55238-20ul |
| Price | |
| Order / More Info | PDAP1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |