| Edit |   |
|---|
| Antigenic Specificity | PDAP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PDAP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PDAP1. This antibody reacts with human. The PDAP1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PDAP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EKKSLDSDESEDEEDDYQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRRERE |
|---|
| Other Names | HASPP28, PAP1PDGFA-associated protein 1, PAP28 kDa heat- and acid-stable phosphoprotein, PDGFA associated protein 1, PDGF-associated protein |
|---|
| Gene, Accession # | PDAP1, Gene ID: 11333, Accession: Q13442, SwissProt: Q13442 |
|---|
| Catalog # | NBP2-38621 |
|---|
| Price | |
|---|
| Order / More Info | PDAP1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|