| 产品详情 |
| Edit |   |
| Antigenic Specificity | GRP78/HSPA5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GRP78/HSPA5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GRP78/HSPA5. This antibody reacts with human, mouse, rat. The GRP78/HSPA5 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat GRP78/HSPA5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFYEGEDFSETLTRAK |
| Other Names | 78 kDa glucose-regulated protein, BiP, Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78, FLJ26106, GRP-78, GRP78BIP, Heat shock 70 kDa protein 5, heat shock 70kD protein 5 (glucose-regulated protein, 78kD), heat shock 70kDa protein 5 (glucose-regulated protein, 78kDa), Immunoglobulin heavy chain-binding protein, MIF2 |
| Gene, Accession # | HSPA5, Gene ID: 3309 |
| Catalog # | NBP1-89968 |
| Price | |
| Order / More Info | GRP78/HSPA5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|