| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Claudin-18 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Claudin-18 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Claudin-18. This antibody reacts with human. The Claudin-18 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Claudin-18 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MMCIACRGLAPEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDYV |
|---|
| Other Names | claudin 18, claudin-18, DKFZp564B2062, SFTA5, SFTPJ, surfactant associated 5, surfactant associated protein J, surfactant, pulmonary associated protein J |
|---|
| Gene, Accession # | CLDN18, Gene ID: 51208, Accession: P56856, SwissProt: P56856 |
|---|
| Catalog # | NBP2-32002 |
|---|
| Price | |
|---|
| Order / More Info | Claudin-18 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|