| Edit |   |
| Antigenic Specificity | Claudin-15 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Claudin-15 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Claudin-15. This antibody reacts with human. The Claudin-15 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to CLDN15(claudin 15) The peptide sequence was selected from the middle region of CLDN15. Peptide sequence LSGYIQACRALMITAILLGFLGLLLGIAGLRCTNIGGLELSRKAKLAATA. |
| Other Names | claudin 15, claudin-15, FLJ42715, MGC19536 |
| Gene, Accession # | CLDN15, Gene ID: 24146, Accession: P56746, SwissProt: P56746 |
| Catalog # | NBP1-59267 |
| Price | |
| Order / More Info | Claudin-15 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |