| Edit |   |
|---|
| Antigenic Specificity | Claudin-15 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Claudin-15 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Claudin-15. This antibody reacts with human. The Claudin-15 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to CLDN15(claudin 15) The peptide sequence was selected from the middle region of CLDN15. Peptide sequence LSGYIQACRALMITAILLGFLGLLLGIAGLRCTNIGGLELSRKAKLAATA. |
|---|
| Other Names | claudin 15, claudin-15, FLJ42715, MGC19536 |
|---|
| Gene, Accession # | CLDN15, Gene ID: 24146, Accession: P56746, SwissProt: P56746 |
|---|
| Catalog # | NBP1-59267-20ul |
|---|
| Price | |
|---|
| Order / More Info | Claudin-15 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|