| Edit |   |
|---|
| Antigenic Specificity | Clathrin light chain + heavy chain |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Clathrin light chain + heavy chain Antibody from Novus Biologicals is a rabbit polyclonal antibody to Clathrin light chain + heavy chain. This antibody reacts with human. The Clathrin light chain + heavy chain Antibody has been validated for the following applications: Western Blot, Immunohistochemistry. |
|---|
| Immunogen | Synthetic peptides corresponding to CLTA (clathrin, light chain (Lca)) The peptide sequence was selected from the C terminal of CLTA. Peptide sequence KELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTEWERVARLCDF. |
|---|
| Other Names | clathrin light chain A, clathrin, light chain A, LCA, light polypeptide (Lca) |
|---|
| Gene, Accession # | CLTA, Gene ID: 1211 |
|---|
| Catalog # | NBP1-69194-20ul |
|---|
| Price | |
|---|
| Order / More Info | Clathrin light chain + heavy chain Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|