Edit |   |
Antigenic Specificity | Tmem178 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | mouse |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit Polyclonal anti-Tmem178 Antibody |
Immunogen | The immunogen for Anti-Tmem178 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Tmem178. Synthetic peptide located within the following region: PDQKNRLMPLSHLPLRDSPPLGRRLLPGGPGRSDPESWRSLLGLGGLDAE |
Other Names | n/a |
Gene, Accession # | Tmem178, Accession: NM_026516 |
Catalog # | TA329555 |
Price | |
Order / More Info | Tmem178 Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |