| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Serpin D1/Heparin Cofactor II |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Serpin D1/Heparin Cofactor II Antibody from Novus Biologicals is a rabbit polyclonal antibody to Serpin D1/Heparin Cofactor II. This antibody reacts with human. The Serpin D1/Heparin Cofactor II Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Serpin D1/Heparin Cofactor II antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EAQIADFSDPAFISKTNNHIMKLTKGLIKDALENIDPATQMMILNCIYFKGSWVNKFPVEMTHNHNFRLNE |
|---|
| Other Names | HC2LS2, HCF2clade D (heparin cofactor), member 1, HC-II, Heparin cofactor II, HLS2HCII, leuserpin 2, Protease inhibitor leuserpin-2, Serpin D1, serpin peptidase inhibitor, clade D (heparin cofactor), member 1 |
|---|
| Gene, Accession # | SERPIND1, Gene ID: 3053, Accession: P05546, SwissProt: P05546 |
|---|
| Catalog # | NBP2-33764 |
|---|
| Price | |
|---|
| Order / More Info | Serpin D1/Heparin Cofactor II Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|