| 产品详情 |
| Edit |   |
| Antigenic Specificity | Serpin C1/Antithrombin-III |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Serpin C1/Antithrombin-III Antibody from Novus Biologicals is a rabbit polyclonal antibody to Serpin C1/Antithrombin-III. This antibody reacts with human. The Serpin C1/Antithrombin-III Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
| Immunogen | Synthetic peptides corresponding to SERPINC1(serpin peptidase inhibitor, clade C (antithrombin), member 1) The peptide sequence was selected from the middle region of SERPINC1. Peptide sequence ISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFN |
| Other Names | AT3antithrombin-III, ATIIIantithrombin III, MGC22579, serine (or cysteine) proteinase inhibitor, clade C (antithrombin), member 1, serine-cysteine proteinase inhibitor clade C member 1, Serpin C1, serpin peptidase inhibitor, clade C (antithrombin), member 1 |
| Gene, Accession # | SERPINC1, Gene ID: 462, Accession: P01008, SwissProt: P01008 |
| Catalog # | NBP1-57918-20ul |
| Price | |
| Order / More Info | Serpin C1/Antithrombin-III Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|