| Edit |   |
|---|
| Antigenic Specificity | NRARP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NRARP Antibody from Novus Biologicals is a rabbit polyclonal antibody to NRARP. This antibody reacts with human. The NRARP Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to NRARP(Notch-regulated ankyrin repeat protein) The peptide sequence was selected from the middle region of NRARP (NP_001004354). Peptide sequence QNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDG. |
|---|
| Other Names | MGC61598, NOTCH-regulated ankyrin repeat protein, notch-regulated ankyrin repeat-containing protein |
|---|
| Gene, Accession # | NRARP, Gene ID: 441478, Accession: Q7Z6K4, SwissProt: Q7Z6K4 |
|---|
| Catalog # | NBP1-56421 |
|---|
| Price | |
|---|
| Order / More Info | NRARP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 12477932 |
|---|