| Edit |   |
|---|
| Antigenic Specificity | NRAMP2/SLC11A2/DMT1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NRAMP2/SLC11A2/DMT1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NRAMP2/SLC11A2/DMT1. This antibody reacts with human. The NRAMP2/SLC11A2/DMT1 Antibody has been validated for the following applications: Western Blot. Specific to all four isoforms of the SLC11A2 transporter |
|---|
| Immunogen | Synthetic peptides corresponding to SLC11A2 The peptide sequence was selected from the N terminal of SLC11A2 (NP_000608). Peptide sequence VLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYF. |
|---|
| Other Names | DCT1NRAMP 2, Divalent cation transporter 1, Divalent metal transporter 1, DMT-1, DMT1FLJ37416, member 2, NRAMP2natural resistance-associated macrophage protein 2, solute carrier family 11 (proton-coupled divalent metal ion transporters) |
|---|
| Gene, Accession # | SLC11A2, Gene ID: 4891, Accession: Q498Z5, SwissProt: Q498Z5 |
|---|
| Catalog # | NBP1-59869 |
|---|
| Price | |
|---|
| Order / More Info | NRAMP2/SLC11A2/DMT1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24746839, 30577543 |
|---|