| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NRAMP1/SLC11A1 |
|---|
| Clone | 2G2 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NRAMP1/SLC11A1 Antibody (2G2) from Novus Biologicals is a mouse monoclonal antibody to NRAMP1/SLC11A1. This antibody reacts with human, mouse. The NRAMP1/SLC11A1 Antibody (2G2) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | SLC11A1 (NP_000569.2 308 a.a. - 350 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QAFYQKTNQAAFNICANSSLHDYAKIFPMNNATVAVDIYQGGV |
|---|
| Other Names | natural resistance-associated macrophage protein 1, LSH, member 1, NRAMP 1, NRAMP1solute carrier family 11 (sodium/phosphate symporters), member 1, NRAMPnatural resistance-associated macrophage protein 1, solute carrier family 11 (proton-coupled divalent metal ion transporters) |
|---|
| Gene, Accession # | SLC11A1, Gene ID: 6556, Accession: NP_000569, SwissProt: NP_000569 |
|---|
| Catalog # | H00006556-M01 |
|---|
| Price | |
|---|
| Order / More Info | NRAMP1/SLC11A1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23191958, 23509347 |
|---|
| 产品资料 |
|
|