Edit |   |
Antigenic Specificity | RNF38 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 100ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit Polyclonal Anti-RNF38 Antibody |
Immunogen | The immunogen for anti-RNF38 antibody: synthetic peptide directed towards the N terminal of human RNF38. Synthetic peptide located within the following region: FDYTSASPAPSPPMRPWEMTSNRQPPSVRPSQHHFSGERCNTPARNRRSP |
Other Names | ring finger protein 38 |
Gene, Accession # | RNF38, Accession: NM_022781 |
Catalog # | TA330460 |
Price | |
Order / More Info | RNF38 Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |