Edit |   |
Antigenic Specificity | RNF182 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | n/a |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit Polyclonal Anti-RNF182 Antibody |
Immunogen | The immunogen for anti-RNF182 antibody: synthetic peptide directed towards the middle region of human RNF182. Synthetic peptide located within the following region: LSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLLFQTSIRVLVWLLGLLY |
Other Names | n/a |
Gene, Accession # | RNF182, Accession: NM_152737 |
Catalog # | TA330520 |
Price | |
Order / More Info | RNF182 Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |