| Edit |   |
| Antigenic Specificity | ESYT3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ESYT3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ESYT3. This antibody reacts with human. The ESYT3 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human FAM62C. Peptide sequence EVFEFMVYEVPGQDLEVDLYDEDTDRDDFLGSLQICLGDVMTNRVVDEWF. |
| Other Names | chr3 synaptotagmin, CHR3SYT, extended synaptotagmin-like protein 3, member C |
| Gene, Accession # | ESYT3, Gene ID: 83850, Accession: NP_114119, SwissProt: NP_114119 |
| Catalog # | NBP1-91355 |
| Price | |
| Order / More Info | ESYT3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |