| Edit |   |
| Antigenic Specificity | RNF170 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-RNF170 Antibody |
| Immunogen | The immunogen for anti-RNF170 antibody: synthetic peptide directed towards the C terminal of human RNF170. Synthetic peptide located within the following region: FYLISPLDFVPEALFGILGFLDDFFVIFLLLIYISIMYREVITQRLTR |
| Other Names | ADSA, SNAX1, ring finger protein 170 |
| Gene, Accession # | RNF170, Accession: NM_030954 |
| Catalog # | TA330478 |
| Price | |
| Order / More Info | RNF170 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |