| Edit |   |
|---|
| Antigenic Specificity | ESYT3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ESYT3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ESYT3. This antibody reacts with human. The ESYT3 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human FAM62C. Peptide sequence EVFEFMVYEVPGQDLEVDLYDEDTDRDDFLGSLQICLGDVMTNRVVDEWF. |
|---|
| Other Names | chr3 synaptotagmin, CHR3SYT, extended synaptotagmin-like protein 3, member C |
|---|
| Gene, Accession # | ESYT3, Gene ID: 83850, Accession: NP_114119, SwissProt: NP_114119 |
|---|
| Catalog # | NBP1-91355-20ul |
|---|
| Price | |
|---|
| Order / More Info | ESYT3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|